Limba
|
APrEST76492-100ul, PrEST Antigen SIKE1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SIKE1, Gene description: suppressor of IKBKE 1, Alternative Gene Names: FLJ21168, SIKE, Antigen sequence: AEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SIKE1, Gene description: suppressor of IKBKE 1, Alternative Gene Names: FLJ21168, SIKE, Antigen sequence: AEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|