APrEST76332-100ul, PrEST Antigen SBSPON Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SBSPON, Gene description: somatomedin B and thrombospondin, type 1 domain containing, Alternative Gene Names: RPESP, Antigen sequence: GWRLDRVYGTCFCDQACRFTGDCCFDYDRACPARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SBSPON, Gene description: somatomedin B and thrombospondin, type 1 domain containing, Alternative Gene Names: RPESP, Antigen sequence: GWRLDRVYGTCFCDQACRFTGDCCFDYDRACPARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|