APrEST76290-100ul, PrEST Antigen LONRF1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen LONRF1, Gene description: LON peptidase N-terminal domain and ring finger 1, Alternative Gene Names: FLJ23749, RNF191, Antigen sequence: EQDVIVNEDGRNKLKKQGETPNEVCMFSLAYGDIPEELIDVSDFECSLCMRLFFEPVTTPCGHSFCKNC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen LONRF1, Gene description: LON peptidase N-terminal domain and ring finger 1, Alternative Gene Names: FLJ23749, RNF191, Antigen sequence: EQDVIVNEDGRNKLKKQGETPNEVCMFSLAYGDIPEELIDVSDFECSLCMRLFFEPVTTPCGHSFCKNC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|