APrEST76056-100ul, PrEST Antigen ZBTB49 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ZBTB49, Gene description: zinc finger and BTB domain containing 49, Alternative Gene Names: FLJ38559, ZNF509, Antigen sequence: AFSQYFRSLFQNSSSQKNDVFHLDVKNVSGIGQILDFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCHTFLKSATVVQPPGMPCNSTLSLQSTLTPDATCVISENYP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ZBTB49, Gene description: zinc finger and BTB domain containing 49, Alternative Gene Names: FLJ38559, ZNF509, Antigen sequence: AFSQYFRSLFQNSSSQKNDVFHLDVKNVSGIGQILDFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCHTFLKSATVVQPPGMPCNSTLSLQSTLTPDATCVISENYP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|