APrEST75958-100ul, PrEST Antigen NBR1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen NBR1, Gene description: neighbor of BRCA1 gene 1, Alternative Gene Names: 1A1-3B, CA125, KIAA0049, M17S2, Antigen sequence: KLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen NBR1, Gene description: neighbor of BRCA1 gene 1, Alternative Gene Names: 1A1-3B, CA125, KIAA0049, M17S2, Antigen sequence: KLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|