APrEST75932-100ul, PrEST Antigen ANKFY1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ANKFY1, Gene description: ankyrin repeat and FYVE domain containing 1, Alternative Gene Names: ANKHZN, KIAA1255, ZFYVE14, Antigen sequence: SPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYEC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ANKFY1, Gene description: ankyrin repeat and FYVE domain containing 1, Alternative Gene Names: ANKHZN, KIAA1255, ZFYVE14, Antigen sequence: SPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYEC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|