APrEST75792-100ul, PrEST Antigen BAHCC1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen BAHCC1, Gene description: BAH domain and coiled-coil containing 1, Alternative Gene Names: BAHD2, KIAA1447, Antigen sequence: SLGLLCAELRGGSGGEPAKKRSKLERSVYAGLQTASVEKAQCKKSSCQGGLAPSVAHRVAQLKPKVKSKGLPTGLSSFQQKEATPGGRIREKLSRAK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen BAHCC1, Gene description: BAH domain and coiled-coil containing 1, Alternative Gene Names: BAHD2, KIAA1447, Antigen sequence: SLGLLCAELRGGSGGEPAKKRSKLERSVYAGLQTASVEKAQCKKSSCQGGLAPSVAHRVAQLKPKVKSKGLPTGLSSFQQKEATPGGRIREKLSRAK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|