APrEST75706-100ul, PrEST Antigen TACO1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TACO1, Gene description: translational activator of mitochondrially encoded cytochrome c oxidase I, Alternative Gene Names: CCDC44, Antigen sequence: ERSRIFSKLCLNIRLAVKEGGPNPEHNSNLANILEVCRSKHMPKSTIETALKMEKSKDTYLLYEGRGPGGSSLLIE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TACO1, Gene description: translational activator of mitochondrially encoded cytochrome c oxidase I, Alternative Gene Names: CCDC44, Antigen sequence: ERSRIFSKLCLNIRLAVKEGGPNPEHNSNLANILEVCRSKHMPKSTIETALKMEKSKDTYLLYEGRGPGGSSLLIE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|