APrEST75361-100ul, PrEST Antigen GAPVD1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen GAPVD1, Gene description: GTPase activating protein and VPS9 domains 1, Alternative Gene Names: DKFZP434C212, KIAA1521, Antigen sequence: SSLDLEGESVSELGAGPSGSNGVEALQLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVLGSDFDPNIDEDRLQEIAGAAAENMLGSLLCLPGSGSVLL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen GAPVD1, Gene description: GTPase activating protein and VPS9 domains 1, Alternative Gene Names: DKFZP434C212, KIAA1521, Antigen sequence: SSLDLEGESVSELGAGPSGSNGVEALQLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVLGSDFDPNIDEDRLQEIAGAAAENMLGSLLCLPGSGSVLL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|