Limba
|
APrEST75192-100ul, PrEST Antigen ECM2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ECM2, Gene description: extracellular matrix protein 2, female organ and adipocyte specific, Antigen sequence: EGEEDEEDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLELTGNSIASIPDEAFNGL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ECM2, Gene description: extracellular matrix protein 2, female organ and adipocyte specific, Antigen sequence: EGEEDEEDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLELTGNSIASIPDEAFNGL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|