APrEST75024-100ul, PrEST Antigen ASZ1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ASZ1, Gene description: ankyrin repeat, SAM and basic leucine zipper domain containing 1, Alternative Gene Names: ALP1, ANKL1, C7orf7, CT1.19, GASZ, Orf3, Antigen sequence: DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ASZ1, Gene description: ankyrin repeat, SAM and basic leucine zipper domain containing 1, Alternative Gene Names: ALP1, ANKL1, C7orf7, CT1.19, GASZ, Orf3, Antigen sequence: DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|