APrEST74949-100ul, PrEST Antigen FAM126A Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FAM126A, Gene description: family with sequence similarity 126, member A, Alternative Gene Names: DRCTNNB1A , 'HCC', DRCTNNB1A, HCC, HYCC1, hyccin, Antigen sequence: PSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEKLIYVSERTELPMKHQSGQQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen FAM126A, Gene description: family with sequence similarity 126, member A, Alternative Gene Names: DRCTNNB1A , 'HCC', DRCTNNB1A, HCC, HYCC1, hyccin, Antigen sequence: PSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEKLIYVSERTELPMKHQSGQQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|