APrEST74899-100ul, PrEST Antigen GET4 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen GET4, Gene description: golgi to ER traffic protein 4 homolog (S. cerevisiae), Alternative Gene Names: C7orf20, CEE, CGI-20, H_NH1244M04.5, TRC35, Antigen sequence: AVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIELD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen GET4, Gene description: golgi to ER traffic protein 4 homolog (S. cerevisiae), Alternative Gene Names: C7orf20, CEE, CGI-20, H_NH1244M04.5, TRC35, Antigen sequence: AVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIELD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|