APrEST74826-100ul, PrEST Antigen ANKIB1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ANKIB1, Gene description: ankyrin repeat and IBR domain containing 1, Alternative Gene Names: DKFZP434A0225, KIAA1386, Antigen sequence: QDPNINDNLLGNIMAWFHDMNPQSIALIPPATTEISADSQLPCIKDGSEGVKDVELVLPEDSMFEDASVSEGRGTQIEENPLEENILAGEAASQAGDSGNEAANRGDGSDVSSQTPQTSSDWLEQV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ANKIB1, Gene description: ankyrin repeat and IBR domain containing 1, Alternative Gene Names: DKFZP434A0225, KIAA1386, Antigen sequence: QDPNINDNLLGNIMAWFHDMNPQSIALIPPATTEISADSQLPCIKDGSEGVKDVELVLPEDSMFEDASVSEGRGTQIEENPLEENILAGEAASQAGDSGNEAANRGDGSDVSSQTPQTSSDWLEQV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|