APrEST74787-100ul, PrEST Antigen GOPC Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen GOPC, Gene description: golgi-associated PDZ and coiled-coil motif containing, Alternative Gene Names: CAL, dJ94G16.2, FIG, GOPC1, PIST, Antigen sequence: NDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen GOPC, Gene description: golgi-associated PDZ and coiled-coil motif containing, Alternative Gene Names: CAL, dJ94G16.2, FIG, GOPC1, PIST, Antigen sequence: NDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|