APrEST74700-100ul, PrEST Antigen ADAMTS18 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ADAMTS18, Gene description: ADAM metallopeptidase with thrombospondin type 1 motif, 18, Alternative Gene Names: ADAMTS21, Antigen sequence: VFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVST, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ADAMTS18, Gene description: ADAM metallopeptidase with thrombospondin type 1 motif, 18, Alternative Gene Names: ADAMTS21, Antigen sequence: VFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVST, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|