APrEST74669-100ul, PrEST Antigen LRBA Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen LRBA, Gene description: LPS-responsive vesicle trafficking, beach and anchor containing, Alternative Gene Names: BGL, CDC4L, LAB300, LBA, Antigen sequence: SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen LRBA, Gene description: LPS-responsive vesicle trafficking, beach and anchor containing, Alternative Gene Names: BGL, CDC4L, LAB300, LBA, Antigen sequence: SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|