APrEST74252-100ul, PrEST Antigen RFFL Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RFFL, Gene description: ring finger and FYVE-like domain containing E3 ubiquitin protein ligase, Alternative Gene Names: fring, rififylin, RNF189, RNF34L, Antigen sequence: AQATSVPPAQVQENQQANGHVSQDQEEPVYLESVARVPAEDETQSIDSEDSFVPGRRASLSDLTDLEDIEGLTVRQLKEILARNF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen RFFL, Gene description: ring finger and FYVE-like domain containing E3 ubiquitin protein ligase, Alternative Gene Names: fring, rififylin, RNF189, RNF34L, Antigen sequence: AQATSVPPAQVQENQQANGHVSQDQEEPVYLESVARVPAEDETQSIDSEDSFVPGRRASLSDLTDLEDIEGLTVRQLKEILARNF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|