APrEST74239-100ul, PrEST Antigen TRIAP1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TRIAP1, Gene description: TP53 regulated inhibitor of apoptosis 1, Alternative Gene Names: HSPC132, P53CSV, WF-1, Antigen sequence: EACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TRIAP1, Gene description: TP53 regulated inhibitor of apoptosis 1, Alternative Gene Names: HSPC132, P53CSV, WF-1, Antigen sequence: EACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|