APrEST74217-100ul, PrEST Antigen CCAR2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CCAR2, Gene description: cell cycle and apoptosis regulator 2, Alternative Gene Names: DBC-1, DBC1, NET35, Antigen sequence: MLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen CCAR2, Gene description: cell cycle and apoptosis regulator 2, Alternative Gene Names: DBC-1, DBC1, NET35, Antigen sequence: MLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|