APrEST73997-100ul, PrEST Antigen ABTB2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ABTB2, Gene description: ankyrin repeat and BTB (POZ) domain containing 2, Alternative Gene Names: DKFZP586C1619, Antigen sequence: IPTTDILELLSAASLFQLDALQRHCEILCSQTLSMESAVNTYKYAKIHNAPELALFCEGFFLKHMKALLEQDA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ABTB2, Gene description: ankyrin repeat and BTB (POZ) domain containing 2, Alternative Gene Names: DKFZP586C1619, Antigen sequence: IPTTDILELLSAASLFQLDALQRHCEILCSQTLSMESAVNTYKYAKIHNAPELALFCEGFFLKHMKALLEQDA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|