APrEST73841-100ul, PrEST Antigen UHRF2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen UHRF2, Gene description: ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase, Alternative Gene Names: MGC33463, NIRF, RNF107, URF2, Antigen sequence: SEGTLNDCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen UHRF2, Gene description: ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase, Alternative Gene Names: MGC33463, NIRF, RNF107, URF2, Antigen sequence: SEGTLNDCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|