APrEST73820-100ul, PrEST Antigen PPWD1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen PPWD1, Gene description: peptidylprolyl isomerase domain and WD repeat containing 1, Alternative Gene Names: KIAA0073, Antigen sequence: QAEGPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen PPWD1, Gene description: peptidylprolyl isomerase domain and WD repeat containing 1, Alternative Gene Names: KIAA0073, Antigen sequence: QAEGPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|