APrEST73815-100ul, PrEST Antigen ASAP3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ASAP3, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 3, Alternative Gene Names: CENTB6, DDEFL1, FLJ20199, UPLC1, Antigen sequence: KKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCAR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ASAP3, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 3, Alternative Gene Names: CENTB6, DDEFL1, FLJ20199, UPLC1, Antigen sequence: KKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCAR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|