APrEST73790-100ul, PrEST Antigen SUPT5H Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SUPT5H, Gene description: suppressor of Ty 5 homolog (S. cerevisiae), Alternative Gene Names: FLJ34157, SPT5, SPT5H, Antigen sequence: VGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SUPT5H, Gene description: suppressor of Ty 5 homolog (S. cerevisiae), Alternative Gene Names: FLJ34157, SPT5, SPT5H, Antigen sequence: VGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|