APrEST72932-100ul, PrEST Antigen FAM171A2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FAM171A2, Gene description: family with sequence similarity 171, member A2, Alternative Gene Names: MGC34829, Antigen sequence: RAFPAFLGTEASSSGNGSWLELMPLTAVSVHLLTGNGTEVPLSGPIHLSLPVPSETRALTVGTSIPAWRFDPKSGLWVRNGTGVIRKEGRQLYWTF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen FAM171A2, Gene description: family with sequence similarity 171, member A2, Alternative Gene Names: MGC34829, Antigen sequence: RAFPAFLGTEASSSGNGSWLELMPLTAVSVHLLTGNGTEVPLSGPIHLSLPVPSETRALTVGTSIPAWRFDPKSGLWVRNGTGVIRKEGRQLYWTF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|