APrEST72667-100ul, PrEST Antigen TMEFF2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TMEFF2, Gene description: transmembrane protein with EGF-like and two follistatin-like domains 2, Alternative Gene Names: CT120.2, HPP1, TENB2, TPEF, TR, Antigen sequence: FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TMEFF2, Gene description: transmembrane protein with EGF-like and two follistatin-like domains 2, Alternative Gene Names: CT120.2, HPP1, TENB2, TPEF, TR, Antigen sequence: FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|