APrEST72335-100ul, PrEST Antigen C1QTNF12 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen C1QTNF12, Gene description: C1q and tumor necrosis factor related protein 12, Alternative Gene Names: C1QDC2, C1QTNF12, MGC105127, Antigen sequence: DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHEFQELLKEATERRFSGLLD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen C1QTNF12, Gene description: C1q and tumor necrosis factor related protein 12, Alternative Gene Names: C1QDC2, C1QTNF12, MGC105127, Antigen sequence: DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHEFQELLKEATERRFSGLLD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|