APrEST71876-100ul, PrEST Antigen VAPB Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen VAPB, Gene description: VAMP (vesicle-associated membrane protein)-associated protein B and C, Alternative Gene Names: ALS8, VAP-B, VAP-C, Antigen sequence: VWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen VAPB, Gene description: VAMP (vesicle-associated membrane protein)-associated protein B and C, Alternative Gene Names: ALS8, VAP-B, VAP-C, Antigen sequence: VWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|