APrEST71579-100ul, PrEST Antigen CGREF1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CGREF1, Gene description: cell growth regulator with EF-hand domain 1, Alternative Gene Names: CGR11, Antigen sequence: PKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSREQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELINFPGVALRHVEPG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen CGREF1, Gene description: cell growth regulator with EF-hand domain 1, Alternative Gene Names: CGR11, Antigen sequence: PKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSREQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELINFPGVALRHVEPG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|