APrEST71479-100ul, PrEST Antigen CCAR1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CCAR1, Gene description: cell division cycle and apoptosis regulator 1, Alternative Gene Names: CARP-1, CARP1, FLJ10590, Antigen sequence: KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CCAR1, Gene description: cell division cycle and apoptosis regulator 1, Alternative Gene Names: CARP-1, CARP1, FLJ10590, Antigen sequence: KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|