APrEST71453-100ul, PrEST Antigen ANKK1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ANKK1, Gene description: ankyrin repeat and kinase domain containing 1, Alternative Gene Names: X-kinase, Antigen sequence: EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ANKK1, Gene description: ankyrin repeat and kinase domain containing 1, Alternative Gene Names: X-kinase, Antigen sequence: EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|