APrEST71288-100ul, PrEST Antigen HECW1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen HECW1, Gene description: HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1, Alternative Gene Names: KIAA0322, NEDL1, Antigen sequence: EEEEKEQEEEGDVSTLEQGEGRLQLRASVKRKSRPCSLPVSELETVIASACGDPETPRTHYIRIHTLLHSMPSAQGGSAAEEEDGAEEESTLKDSSEKDGLSEVDTVAADPSALE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen HECW1, Gene description: HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1, Alternative Gene Names: KIAA0322, NEDL1, Antigen sequence: EEEEKEQEEEGDVSTLEQGEGRLQLRASVKRKSRPCSLPVSELETVIASACGDPETPRTHYIRIHTLLHSMPSAQGGSAAEEEDGAEEESTLKDSSEKDGLSEVDTVAADPSALE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|