APrEST70953-100ul, PrEST Antigen ZBTB7B Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ZBTB7B, Gene description: zinc finger and BTB domain containing 7B, Alternative Gene Names: c-Krox, hcKrox, ZBTB15, ZFP67, ZNF857B, Antigen sequence: LLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ZBTB7B, Gene description: zinc finger and BTB domain containing 7B, Alternative Gene Names: c-Krox, hcKrox, ZBTB15, ZFP67, ZNF857B, Antigen sequence: LLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|