APrEST70943-100ul, PrEST Antigen SMARCA5 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SMARCA5, Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5, Alternative Gene Names: hISWI, hSNF2H, ISWI, Antigen sequence: SSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SMARCA5, Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5, Alternative Gene Names: hISWI, hSNF2H, ISWI, Antigen sequence: SSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|