APrEST70831-100ul, PrEST Antigen ZSCAN29 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ZSCAN29, Gene description: zinc finger and SCAN domain containing 29, Alternative Gene Names: FLJ35867, Zfp690, ZNF690, Antigen sequence: TSEAEAQKQAEEADEATEEDSDDDEEDTEIPPGAVITRAPVLFQSPRGFEAGFENEDNSKRDISEEVQLHRTLLARSERKIPRYLHQGKGNESDCRSGRQWAKTSGEKRGKLTLPEKSLSEVLSQQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ZSCAN29, Gene description: zinc finger and SCAN domain containing 29, Alternative Gene Names: FLJ35867, Zfp690, ZNF690, Antigen sequence: TSEAEAQKQAEEADEATEEDSDDDEEDTEIPPGAVITRAPVLFQSPRGFEAGFENEDNSKRDISEEVQLHRTLLARSERKIPRYLHQGKGNESDCRSGRQWAKTSGEKRGKLTLPEKSLSEVLSQQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|