APrEST70181-100ul, PrEST Antigen VWDE Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen VWDE, Gene description: von Willebrand factor D and EGF domains, Alternative Gene Names: FLJ14712, Antigen sequence: YRSVRFDSWHLQQSAVQDLICDHSLSPGWYRFLILDRPAEMPTKCVEMNHCGTQAPIWLSLRDSETLPSPGEIKQLTACATWQFLFSTTKDCCLFQIPVSVRNCGNFFVYLLQPTQGCMGYCA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen VWDE, Gene description: von Willebrand factor D and EGF domains, Alternative Gene Names: FLJ14712, Antigen sequence: YRSVRFDSWHLQQSAVQDLICDHSLSPGWYRFLILDRPAEMPTKCVEMNHCGTQAPIWLSLRDSETLPSPGEIKQLTACATWQFLFSTTKDCCLFQIPVSVRNCGNFFVYLLQPTQGCMGYCA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|