APrEST70102-100ul, PrEST Antigen ITGB2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ITGB2, Gene description: integrin, beta 2 (complement component 3 receptor 3 and 4 subunit), Alternative Gene Names: CD18, LFA-1, MAC-1, MFI7, Antigen sequence: CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ITGB2, Gene description: integrin, beta 2 (complement component 3 receptor 3 and 4 subunit), Alternative Gene Names: CD18, LFA-1, MAC-1, MFI7, Antigen sequence: CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|